LL-37 COA Guide – How to Evaluate Research Product Documentation
Researchers searching for an LL-37 COA are usually trying to answer a straightforward procurement question:
What analytical evidence supports this LL-37 research product?
A Certificate of Analysis can provide valuable information.
However, the existence of a COA shouldn’t automatically be interpreted as proof that every important product characteristic has been independently established.
Researchers should examine what the certificate actually reports.
What Is an LL-37 COA?
A Certificate of Analysis is a document reporting product specifications or analytical results associated with a sample, product, or batch.
Depending on the document, an LL-37 COA may include:
- Product name
- Compound identification
- Batch/lot
- Purity
- Analytical method
- Identity-related information
- Test date
- Additional specifications
The exact fields can vary.
Start With Compound Identity
Before looking at the purity percentage, verify which compound the COA identifies.
The intended material should be:
LL-37
The peptide contains 37 amino-acid residues.
Its sequence is:
[LL-37, 37 aa]
Distinguish LL-37 From hCAP18
A COA should correspond to the actual research material.
LL-37 is derived from hCAP18, but the terms shouldn’t be treated as identical molecular product names.
If the product is sold as LL-37, the analytical documentation should correspond to LL-37.
Check the Batch Number
Look for:
batch
or
lot
information.
Researchers should determine whether the certificate corresponds to the material being purchased.
A COA from an earlier batch shouldn’t automatically be assumed to characterize later inventory.
Check the Analytical Method
A purity result becomes more meaningful when researchers understand how it was generated.
One commonly encountered method is:
HPLC — High-Performance Liquid Chromatography
The COA may also contain or reference identity-related analytical testing.
Understand the Purity Result
If the certificate reports a percentage, determine what that percentage represents.
Ask:
- Is it chromatographic purity?
- Which method produced it?
- Which sample was analyzed?
- Which batch does it represent?
Avoid interpreting the number outside its analytical context.
Purity Isn’t Complete Identity Verification
A chromatographic purity result can provide useful information about sample composition.
However, it doesn’t automatically establish every aspect of molecular identity.
Researchers should review available identity-related testing separately.
Check Supporting Analytical Information
Where available, researchers may want to review:
- Chromatographic information
- Identity-related analytical data
- Batch information
- Additional test records
The COA may be a summary of these results rather than the entirety of the analytical evidence.
Match the COA to the Product
Researchers can review current LL-37 products here:
https://peptideslabus.com/products?q=LL-37
For the 5mg listing:
https://peptideslabus.com/products/ll-37-5mg-research-peptide
Additional listings:
https://peptideslabus.com/products/crown-ll-37-research-peptide
https://peptideslabus.com/products/peptides-lab-ll37
Documentation should be evaluated in relation to the specific product under consideration.
COA vs Product Page
A product page may provide:
- Product name
- Quantity
- Price
- Availability
- General specifications
A COA may provide analytical results associated with the product or batch.
Researchers should use both where appropriate.
Don’t Judge a COA by Design
A polished certificate isn’t automatically analytically stronger.
Focus on:
What was tested?
Which method was used?
What result was obtained?
Which batch does it describe?
These questions are more important than graphic presentation.
LL-37 COA Evaluation Checklist
Before relying on a certificate:
- Confirm the compound is LL-37.
- Review sequence/identity information.
- Check the batch or lot.
- Identify the analytical method.
- Review the reported purity.
- Determine what the percentage represents.
- Review identity-related testing.
- Look for supporting analytical information.
- Match the COA to the relevant product.
- Avoid assuming one historical COA applies to every batch.
Browse Current LL-37 Research Products
https://peptideslabus.com/products?q=LL-37
An LL-37 COA is most useful when researchers evaluate its compound identity, analytical methods, results, and batch relationship rather than simply checking whether a certificate exists.
For laboratory research purposes only.
